Loading...
Statistics
Advertisement

Tax Forms
www.taxforms.com/

Taxforms.com

Advertisement
Conversion Technology Metas Server
Taxforms.com is hosted in United States / Columbus . Taxforms.com uses HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 1. First javascripts: Adsbygoogle.js, Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Taxforms.com

Technology

Number of occurences: 1
  • Html

Advertisement

Javascripts

Number of occurences: 1
  • adsbygoogle.js

Advertise

Number of occurences: 1
  • Google Adsense

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Taxforms.com

SSL certificate

    • name: /C=US/postalCode=43228/ST=OH/L=Columbus/street=1774 Dividend Drive/O=Ecommerce, Inc./OU=Hosted by Ecommerce/OU=Hosted by Ecommerce, Inc./OU=PremiumSSL Wildcard/CN=*.opentransfer.com
    • subject:
      • C: US
      • postalCode: 43228
      • ST: OH
      • L: Columbus
      • street: 1774 Dividend Drive
      • O: Ecommerce, Inc.
      • OU:
        • 0: Hosted by Ecommerce
        • 1: Hosted by Ecommerce, Inc.
        • 2: PremiumSSL Wildcard
      • CN: *.opentransfer.com
    • hash: 461a5c76
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Organization Validation Secure Server CA
    • version: 2
    • serialNumber: 317242894868685377471229806233971550759
    • validFrom: 160706000000Z
    • validTo: 170719235959Z
    • validFrom_time_t: 1467763200
    • validTo_time_t: 1500508799
    • extensions:
      • authorityKeyIdentifier: keyid:9A:F3:2B:DA:CF:AD:4F:B6:2F:BB:2A:48:48:2A:12:B7:1B:42:C1:24
      • subjectKeyIdentifier: DA:2B:5F:41:12:68:8F:C4:71:D4:73:01:AD:C7:82:48:5D:1A:7A:20
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.1.3.4 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.2
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSAOrganizationValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSAOrganizationValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:*.opentransfer.com, DNS:opentransfer.com

Meta - Taxforms.com

Number of occurences: 1
  • Name:
    Content: text/html; charset=ISO-8859-1

Server / Hosting

  • IP: 50.6.15.187
  • Latitude: 39.96
  • Longitude: -83.14
  • Country: United States
  • City: Columbus

Rname

  • ns18.ixwebhosting.com
  • ns17.ixwebhosting.com
  • mail902.ixwebhosting.com

Target

  • admin.ixwebhosting.com

HTTP Header Response

HTTP/1.1 200 OK Date: Thu, 25 Aug 2016 22:20:13 GMT Server: Apache Last-Modified: Sat, 13 Feb 2016 03:36:02 GMT ETag: "17240c9-dd6-52b9e7b98ec80" Accept-Ranges: bytes Content-Length: 3542 Content-Type: text/html X-Cache: MISS from s_wx1123 X-Cache-Lookup: MISS from s_wx1123:80 Via: 1.1 s_wx1123 (squid/3.5.16) Connection: keep-alive

DNS

host: taxforms.com
  1. class: IN
  2. ttl: 86400
  3. type: A
  4. ip: 50.6.15.187
host: taxforms.com
  1. class: IN
  2. ttl: 21600
  3. type: NS
  4. target: ns18.ixwebhosting.com
host: taxforms.com
  1. class: IN
  2. ttl: 21600
  3. type: NS
  4. target: ns17.ixwebhosting.com
host: taxforms.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns17.ixwebhosting.com
  5. rname: admin.ixwebhosting.com
  6. serial: 2014072104
  7. refresh: 10800
  8. retry: 3600
  9. expire: 604800
  10. minimum-ttl: 86400
host: taxforms.com
  1. class: IN
  2. ttl: 86400
  3. type: MX
  4. pri: 10
  5. target: mail902.ixwebhosting.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.axforms.com, www.tqaxforms.com, www.qaxforms.com, www.taaxforms.com, www.aaxforms.com, www.t axforms.com, www. axforms.com, www.twaxforms.com, www.waxforms.com, www.teaxforms.com, www.eaxforms.com, www.tzaxforms.com, www.zaxforms.com, www.txaxforms.com, www.xaxforms.com, www.tcaxforms.com, www.caxforms.com, www.txforms.com, www.taoxforms.com, www.toxforms.com, www.tapxforms.com, www.tpxforms.com, www.ta9xforms.com, www.t9xforms.com, www.taxforms.com, www.txforms.com, www.taixforms.com, www.tixforms.com, www.tauxforms.com, www.tuxforms.com, www.taforms.com, www.taxqforms.com, www.taqforms.com, www.taxforms.com, www.taforms.com, www.taxaforms.com, www.taaforms.com, www.taxsforms.com, www.tasforms.com, www.taxdforms.com, www.tadforms.com, www.taxeforms.com, www.taeforms.com, www.taxorms.com, www.taxfqorms.com, www.taxqorms.com, www.taxforms.com, www.taxorms.com, www.taxfaorms.com, www.taxaorms.com, www.taxfyorms.com, www.taxyorms.com, www.taxftorms.com, www.taxtorms.com, www.taxfgorms.com, www.taxgorms.com, www.taxfborms.com, www.taxborms.com, www.taxfworms.com, www.taxworms.com, www.taxfsorms.com, www.taxsorms.com, www.taxfdorms.com, www.taxdorms.com, www.taxfrorms.com, www.taxrorms.com, www.taxf3orms.com, www.tax3orms.com, www.taxf4orms.com, www.tax4orms.com, www.taxfrms.com, www.taxfobrms.com, www.taxfbrms.com, www.taxfohrms.com, www.taxfhrms.com, www.taxfogrms.com, www.taxfgrms.com, www.taxfojrms.com, www.taxfjrms.com, www.taxfomrms.com, www.taxfmrms.com, www.taxfo rms.com, www.taxf rms.com, www.taxfovrms.com, www.taxfvrms.com, www.taxfoms.com, www.taxforims.com, www.taxfoims.com, www.taxforoms.com, www.taxfooms.com, www.taxforlms.com, www.taxfolms.com, www.taxforlms.com, www.taxfolms.com, www.taxfor.ms.com, www.taxfo.ms.com, www.taxfors.com, www.taxformps.com, www.taxforps.com, www.taxformos.com, www.taxforos.com, www.taxformis.com, www.taxforis.com, www.taxformks.com, www.taxforks.com, www.taxform.s.com, www.taxfor.s.com, www.taxformus.com, www.taxforus.com, www.taxformjs.com, www.taxforjs.com, www.taxformns.com, www.taxforns.com, www.taxform-s.com, www.taxfor-s.com, www.taxform.com, www.taxformse.com, www.taxforme.com, www.taxformsw.com, www.taxformw.com, www.taxformsd.com, www.taxformd.com, www.taxformsx.com, www.taxformx.com, www.taxformsf.com, www.taxformf.com, www.taxformsg.com, www.taxformg.com, www.taxformst.com, www.taxformt.com,

Other websites we recently analyzed

  1. 기업건설정보
    디스크립션
    Korea, Republic of - 112.175.85.143
    Server software: nginx
    Technology: CSS, Html, Html5, Javascript, jQuery, jQuery UI, Php
    Number of Javascript: 6
    Number of meta tags: 3
  2. ifashion
    ifashion
    Lithuania - 79.98.25.28
    G Analytics ID: UA-53267986-1
    Server software: Apache
    Technology: Carousel, CSS, Html, Html5, Javascript, jQuery Colorbox, jQuery Cookie, jQuery UI, Php, Google Analytics
    Number of Javascript: 11
    Number of meta tags: 4
  3. Home - ATER Viterbo
    Azienda Territoriale per l’Edilizia Residenziale Pubblica della Provincia di Viterbo
    Arezzo (Italy) - 62.149.142.90
    Server software: Apache
    Technology: CSS, Html, Iframe, Javascript, jQuery, Php, Joomla
    Number of Javascript: 7
    Number of meta tags: 4
  4. tuckerbicycle
    Check out this GoDaddy hosted webpage! http://tuckerbicycle.com.
    Scottsdale (United States) - 97.74.42.79
    Server software: Microsoft-IIS/7.0
    Technology: CSS, Html, Javascript, jQuery, jQuery UI
    Number of Javascript: 4
    Number of meta tags: 3
  5. Lehigh Cottage
    Scottsdale (United States) - 97.74.141.128
    Server software: Apache
    Technology: CSS, Html, Javascript, jQuery
    Number of Javascript: 4
    Number of meta tags: 4
  6. MK MEDIA - Интернет-маркетинг
    MK MEDIA - Интернет-маркетинг
    Russian Federation - 77.222.56.94
    Server software: nginx/1.9.12
    Technology: CSS, Html, Html5, Javascript, LiveInternet counter
    Number of Javascript: 1
    Number of meta tags: 4
  7. Welcome to COLORADOSPRINGSCRIMINALDEFENSELAWYER.COM
    Scottsdale (United States) - 184.168.221.96
    Server software: Microsoft-IIS/7.5
    Technology: Google Adsense, CSS, Html, Javascript
    Number of Javascript: 3
    Number of meta tags: 2
  8. Home
    Brea (United States) - 69.163.144.16
    Server software: Apache
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 6
    Number of meta tags: 2
  9. Trakehner France - Association Française du Trakehner
    Trakehner France - Site officiel de AFT - Association Française du Trakehner - Histoire - Chevaux - Elevages - Trakehner Frankreich
    United States - 159.100.190.4
    Server software: Apache
    Technology: CSS, Html, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 7
    Number of meta tags: 10
  10. jesusair.org
    Scottsdale (United States) - 50.63.202.55
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe

Check Other Websites